Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3121329..3121933 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag QRF08_RS14915 Protein ID WP_003414492.1
Coordinates 3121329..3121721 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag QRF08_RS14920 Protein ID WP_003414495.1
Coordinates 3121718..3121933 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS14885 (QRF08_14885) 3116479..3117267 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
QRF08_RS14890 (QRF08_14890) 3117601..3118146 - 546 WP_014584866.1 DUF1802 family protein -
QRF08_RS14895 (QRF08_14895) 3118418..3119302 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QRF08_RS14900 (QRF08_14900) 3119305..3120192 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
QRF08_RS14905 (QRF08_14905) 3120497..3121042 - 546 WP_003910939.1 DUF1802 family protein -
QRF08_RS14910 (QRF08_14910) 3121039..3121308 - 270 WP_003414489.1 DUF2277 family protein -
QRF08_RS14915 (QRF08_14915) 3121329..3121721 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF08_RS14920 (QRF08_14920) 3121718..3121933 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRF08_RS14925 (QRF08_14925) 3121980..3122729 + 750 WP_003902358.1 enoyl-CoA hydratase -
QRF08_RS14930 (QRF08_14930) 3122808..3123890 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
QRF08_RS14935 (QRF08_14935) 3123883..3125193 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
QRF08_RS14940 (QRF08_14940) 3125196..3126023 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
QRF08_RS14945 (QRF08_14945) 3126020..3126931 - 912 WP_286018087.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T283981 WP_003414492.1 NZ_CP127276:c3121721-3121329 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT283981 WP_003414495.1 NZ_CP127276:c3121933-3121718 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References