Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3094975..3095545 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | QRF08_RS14770 | Protein ID | WP_003414166.1 |
| Coordinates | 3094975..3095331 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | QRF08_RS14775 | Protein ID | WP_003901465.1 |
| Coordinates | 3095315..3095545 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS14750 (QRF08_14750) | 3090427..3092115 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| QRF08_RS14755 (QRF08_14755) | 3092119..3092445 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| QRF08_RS14760 (QRF08_14760) | 3092618..3093205 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
| QRF08_RS14765 (QRF08_14765) | 3093224..3094873 | + | 1650 | Protein_2914 | CocE/NonD family hydrolase | - |
| QRF08_RS14770 (QRF08_14770) | 3094975..3095331 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| QRF08_RS14775 (QRF08_14775) | 3095315..3095545 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| QRF08_RS14780 (QRF08_14780) | 3095588..3096631 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| QRF08_RS14785 (QRF08_14785) | 3096630..3097097 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| QRF08_RS14790 (QRF08_14790) | 3097273..3097527 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| QRF08_RS14795 (QRF08_14795) | 3097675..3098079 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| QRF08_RS14800 (QRF08_14800) | 3098076..3098267 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| QRF08_RS14805 (QRF08_14805) | 3098484..3098744 | + | 261 | Protein_2922 | transposase | - |
| QRF08_RS14810 (QRF08_14810) | 3099854..3100111 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| QRF08_RS14815 (QRF08_14815) | 3100216..3100527 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T283979 WP_003414166.1 NZ_CP127276:c3095331-3094975 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|