Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3054978..3055657 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF90 |
| Locus tag | QRF08_RS14540 | Protein ID | WP_003414059.1 |
| Coordinates | 3054978..3055394 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | QRF08_RS14545 | Protein ID | WP_003414061.1 |
| Coordinates | 3055391..3055657 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS14520 (QRF08_14520) | 3051030..3051932 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QRF08_RS14525 (QRF08_14525) | 3052001..3052753 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| QRF08_RS14530 (QRF08_14530) | 3052997..3053272 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| QRF08_RS14535 (QRF08_14535) | 3053269..3054891 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
| QRF08_RS14540 (QRF08_14540) | 3054978..3055394 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
| QRF08_RS14545 (QRF08_14545) | 3055391..3055657 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QRF08_RS14550 (QRF08_14550) | 3055683..3056078 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF08_RS14555 (QRF08_14555) | 3056075..3056344 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QRF08_RS14560 (QRF08_14560) | 3056354..3057448 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
| QRF08_RS14565 (QRF08_14565) | 3057445..3057864 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
| QRF08_RS14570 (QRF08_14570) | 3057863..3057937 | + | 75 | Protein_2875 | hypothetical protein | - |
| QRF08_RS14575 (QRF08_14575) | 3057938..3058417 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| QRF08_RS14580 (QRF08_14580) | 3058488..3059288 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
| QRF08_RS14585 (QRF08_14585) | 3059444..3060181 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T283977 WP_003414059.1 NZ_CP127276:c3055394-3054978 [Mycobacterium tuberculosis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|