Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2914878..2915592 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag QRF08_RS13720 Protein ID WP_003413460.1
Coordinates 2915152..2915592 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag QRF08_RS13715 Protein ID WP_003413456.1
Coordinates 2914878..2915165 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS13680 (QRF08_13680) 2910300..2910545 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF08_RS13685 (QRF08_13685) 2910542..2910946 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
QRF08_RS13690 (QRF08_13690) 2911163..2911783 + 621 WP_003413441.1 DUF4178 domain-containing protein -
QRF08_RS13695 (QRF08_13695) 2911794..2912288 + 495 WP_003413444.1 DUF2617 family protein -
QRF08_RS13700 (QRF08_13700) 2912285..2912716 + 432 WP_003899390.1 DUF4247 domain-containing protein -
QRF08_RS13705 (QRF08_13705) 2912741..2913199 + 459 WP_003413451.1 DUF350 domain-containing protein -
QRF08_RS13710 (QRF08_13710) 2913196..2914767 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
QRF08_RS13715 (QRF08_13715) 2914878..2915165 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
QRF08_RS13720 (QRF08_13720) 2915152..2915592 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF08_RS13725 (QRF08_13725) 2915613..2916368 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
QRF08_RS13730 (QRF08_13730) 2916501..2917097 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
QRF08_RS13735 (QRF08_13735) 2917105..2917950 - 846 WP_003413466.1 acyl-CoA thioesterase II -
QRF08_RS13740 (QRF08_13740) 2917979..2918878 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
QRF08_RS13745 (QRF08_13745) 2919006..2919680 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T283975 WP_003413460.1 NZ_CP127276:2915152-2915592 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT283975 WP_003413456.1 NZ_CP127276:2914878-2915165 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References