Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2853414..2854045 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag QRF08_RS13445 Protein ID WP_003413174.1
Coordinates 2853668..2854045 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag QRF08_RS13440 Protein ID WP_003413167.1
Coordinates 2853414..2853671 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS13410 (QRF08_13410) 2849328..2849642 + 315 WP_009937839.1 hypothetical protein -
QRF08_RS13415 (QRF08_13415) 2849938..2851149 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
QRF08_RS13420 (QRF08_13420) 2851276..2851935 + 660 WP_286014908.1 LppA family lipoprotein -
QRF08_RS13425 (QRF08_13425) 2851932..2852594 + 663 WP_286018084.1 LppA family lipoprotein -
QRF08_RS13430 (QRF08_13430) 2852591..2852869 + 279 WP_041018915.1 type II toxin-antitoxin system VapB family antitoxin -
QRF08_RS13435 (QRF08_13435) 2852962..2853375 + 414 WP_003413164.1 PIN domain nuclease -
QRF08_RS13440 (QRF08_13440) 2853414..2853671 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
QRF08_RS13445 (QRF08_13445) 2853668..2854045 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF08_RS13450 (QRF08_13450) 2854061..2854435 - 375 WP_003413177.1 hypothetical protein -
QRF08_RS13455 (QRF08_13455) 2854535..2854930 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
QRF08_RS13460 (QRF08_13460) 2854927..2855172 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
QRF08_RS13465 (QRF08_13465) 2855583..2856002 - 420 WP_003413190.1 A24 family peptidase -
QRF08_RS13470 (QRF08_13470) 2856014..2856823 - 810 WP_003413193.1 shikimate dehydrogenase -
QRF08_RS13475 (QRF08_13475) 2856820..2858073 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
QRF08_RS13480 (QRF08_13480) 2858066..2858578 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T283973 WP_003413174.1 NZ_CP127276:2853668-2854045 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT283973 WP_003413167.1 NZ_CP127276:2853414-2853671 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References