Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2839075..2839715 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag QRF08_RS13350 Protein ID WP_003412970.1
Coordinates 2839075..2839494 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag QRF08_RS13355 Protein ID WP_003412975.1
Coordinates 2839491..2839715 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS13320 (QRF08_13320) 2834660..2835382 - 723 WP_003412957.1 DUF1906 domain-containing protein -
QRF08_RS13325 (QRF08_13325) 2835899..2836126 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
QRF08_RS13330 (QRF08_13330) 2836123..2836524 + 402 WP_003412963.1 PIN domain-containing protein -
QRF08_RS13335 (QRF08_13335) 2836559..2837479 - 921 WP_003412965.1 restriction endonuclease -
QRF08_RS13340 (QRF08_13340) 2837820..2838065 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF08_RS13345 (QRF08_13345) 2838124..2839074 + 951 WP_003911916.1 ERCC4 domain-containing protein -
QRF08_RS13350 (QRF08_13350) 2839075..2839494 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF08_RS13355 (QRF08_13355) 2839491..2839715 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
QRF08_RS13360 (QRF08_13360) 2839746..2842589 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
QRF08_RS13365 (QRF08_13365) 2842661..2843062 - 402 WP_003412981.1 hypothetical protein -
QRF08_RS13370 (QRF08_13370) 2843062..2843532 - 471 WP_003899364.1 transcription antitermination factor NusB -
QRF08_RS13375 (QRF08_13375) 2843535..2844098 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T283971 WP_003412970.1 NZ_CP127276:c2839494-2839075 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT283971 WP_003412975.1 NZ_CP127276:c2839715-2839491 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References