Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2839075..2839715 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ08 |
| Locus tag | QRF08_RS13350 | Protein ID | WP_003412970.1 |
| Coordinates | 2839075..2839494 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ09 |
| Locus tag | QRF08_RS13355 | Protein ID | WP_003412975.1 |
| Coordinates | 2839491..2839715 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS13320 (QRF08_13320) | 2834660..2835382 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
| QRF08_RS13325 (QRF08_13325) | 2835899..2836126 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QRF08_RS13330 (QRF08_13330) | 2836123..2836524 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
| QRF08_RS13335 (QRF08_13335) | 2836559..2837479 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
| QRF08_RS13340 (QRF08_13340) | 2837820..2838065 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| QRF08_RS13345 (QRF08_13345) | 2838124..2839074 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
| QRF08_RS13350 (QRF08_13350) | 2839075..2839494 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF08_RS13355 (QRF08_13355) | 2839491..2839715 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
| QRF08_RS13360 (QRF08_13360) | 2839746..2842589 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| QRF08_RS13365 (QRF08_13365) | 2842661..2843062 | - | 402 | WP_003412981.1 | hypothetical protein | - |
| QRF08_RS13370 (QRF08_13370) | 2843062..2843532 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
| QRF08_RS13375 (QRF08_13375) | 2843535..2844098 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T283971 WP_003412970.1 NZ_CP127276:c2839494-2839075 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|