Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/- |
| Location | 2387025..2387554 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TMR4 |
| Locus tag | QRF08_RS11235 | Protein ID | WP_003411124.1 |
| Coordinates | 2387025..2387342 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P9WJ74 |
| Locus tag | QRF08_RS11240 | Protein ID | WP_003411127.1 |
| Coordinates | 2387339..2387554 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS11205 (QRF08_11205) | 2382162..2383238 | + | 1077 | WP_003411110.1 | hypothetical protein | - |
| QRF08_RS11210 (QRF08_11210) | 2383235..2383516 | + | 282 | WP_003411112.1 | DUF5703 family protein | - |
| QRF08_RS11215 (QRF08_11215) | 2383552..2384625 | + | 1074 | WP_003901338.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| QRF08_RS11220 (QRF08_11220) | 2384630..2385160 | - | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| QRF08_RS11225 (QRF08_11225) | 2385208..2386554 | - | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
| QRF08_RS11235 (QRF08_11235) | 2387025..2387342 | - | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRF08_RS11240 (QRF08_11240) | 2387339..2387554 | - | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
| QRF08_RS11245 (QRF08_11245) | 2387809..2388867 | + | 1059 | WP_003411129.1 | phosphoribosyltransferase family protein | - |
| QRF08_RS11250 (QRF08_11250) | 2388997..2389353 | - | 357 | WP_003411130.1 | hypothetical protein | - |
| QRF08_RS11255 (QRF08_11255) | 2389448..2390230 | - | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
| QRF08_RS11260 (QRF08_11260) | 2390498..2390788 | - | 291 | WP_003900476.1 | YggT family protein | - |
| QRF08_RS11265 (QRF08_11265) | 2390950..2391606 | - | 657 | WP_003411133.1 | cell division protein SepF | - |
| QRF08_RS11270 (QRF08_11270) | 2391672..2392448 | - | 777 | WP_003411137.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T283969 WP_003411124.1 NZ_CP127276:c2387342-2387025 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAJ4 |