Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2387025..2387554 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag QRF08_RS11235 Protein ID WP_003411124.1
Coordinates 2387025..2387342 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag QRF08_RS11240 Protein ID WP_003411127.1
Coordinates 2387339..2387554 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS11205 (QRF08_11205) 2382162..2383238 + 1077 WP_003411110.1 hypothetical protein -
QRF08_RS11210 (QRF08_11210) 2383235..2383516 + 282 WP_003411112.1 DUF5703 family protein -
QRF08_RS11215 (QRF08_11215) 2383552..2384625 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
QRF08_RS11220 (QRF08_11220) 2384630..2385160 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
QRF08_RS11225 (QRF08_11225) 2385208..2386554 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
QRF08_RS11235 (QRF08_11235) 2387025..2387342 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRF08_RS11240 (QRF08_11240) 2387339..2387554 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
QRF08_RS11245 (QRF08_11245) 2387809..2388867 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
QRF08_RS11250 (QRF08_11250) 2388997..2389353 - 357 WP_003411130.1 hypothetical protein -
QRF08_RS11255 (QRF08_11255) 2389448..2390230 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
QRF08_RS11260 (QRF08_11260) 2390498..2390788 - 291 WP_003900476.1 YggT family protein -
QRF08_RS11265 (QRF08_11265) 2390950..2391606 - 657 WP_003411133.1 cell division protein SepF -
QRF08_RS11270 (QRF08_11270) 2391672..2392448 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T283969 WP_003411124.1 NZ_CP127276:c2387342-2387025 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT283969 WP_003411127.1 NZ_CP127276:c2387554-2387339 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References