Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2305663..2306299 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | QRF08_RS10830 | Protein ID | WP_003410654.1 |
Coordinates | 2305889..2306299 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | QRF08_RS10825 | Protein ID | WP_003410651.1 |
Coordinates | 2305663..2305896 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS10810 (QRF08_10810) | 2301120..2301512 | + | 393 | WP_229303073.1 | metal ABC transporter permease | - |
QRF08_RS10815 (QRF08_10815) | 2301513..2301917 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
QRF08_RS10820 (QRF08_10820) | 2302001..2305585 | - | 3585 | WP_003910889.1 | cobaltochelatase subunit CobN | - |
QRF08_RS10825 (QRF08_10825) | 2305663..2305896 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
QRF08_RS10830 (QRF08_10830) | 2305889..2306299 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
QRF08_RS10835 (QRF08_10835) | 2306283..2307374 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
QRF08_RS10840 (QRF08_10840) | 2307384..2308010 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
QRF08_RS10845 (QRF08_10845) | 2308007..2309533 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
QRF08_RS10850 (QRF08_10850) | 2309479..2310702 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T283967 WP_003410654.1 NZ_CP127276:2305889-2306299 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|