Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2242877..2243503 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | QRF08_RS10550 | Protein ID | WP_003410075.1 |
Coordinates | 2243105..2243503 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | QRF08_RS10545 | Protein ID | WP_003911750.1 |
Coordinates | 2242877..2243104 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS10535 (QRF08_10535) | 2240916..2241260 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
QRF08_RS10540 (QRF08_10540) | 2241449..2242618 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
QRF08_RS10545 (QRF08_10545) | 2242877..2243104 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF08_RS10550 (QRF08_10550) | 2243105..2243503 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
QRF08_RS10555 (QRF08_10555) | 2243686..2244117 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRF08_RS10560 (QRF08_10560) | 2244218..2244652 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
QRF08_RS10565 (QRF08_10565) | 2245089..2245268 | - | 180 | Protein_2088 | hypothetical protein | - |
QRF08_RS10570 (QRF08_10570) | 2245356..2245976 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
QRF08_RS10575 (QRF08_10575) | 2245930..2246520 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
QRF08_RS10580 (QRF08_10580) | 2246648..2247904 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T283965 WP_003410075.1 NZ_CP127276:2243105-2243503 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|