Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2219137..2219723 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | QRF08_RS10445 | Protein ID | WP_003410010.1 |
Coordinates | 2219137..2219481 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | QRF08_RS10450 | Protein ID | WP_003410014.1 |
Coordinates | 2219475..2219723 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS10410 (QRF08_10410) | 2214843..2215442 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
QRF08_RS10415 (QRF08_10415) | 2215858..2216286 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
QRF08_RS10420 (QRF08_10420) | 2216512..2217051 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
QRF08_RS10425 (QRF08_10425) | 2217571..2218131 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
QRF08_RS10430 (QRF08_10430) | 2218128..2218469 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
QRF08_RS10435 (QRF08_10435) | 2218555..2218812 | + | 258 | WP_003410006.1 | hypothetical protein | - |
QRF08_RS10440 (QRF08_10440) | 2218713..2219048 | - | 336 | WP_003410009.1 | dehydrogenase | - |
QRF08_RS10445 (QRF08_10445) | 2219137..2219481 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
QRF08_RS10450 (QRF08_10450) | 2219475..2219723 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QRF08_RS10455 (QRF08_10455) | 2219823..2222138 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
QRF08_RS10460 (QRF08_10460) | 2222135..2222407 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
QRF08_RS10465 (QRF08_10465) | 2222460..2222816 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
QRF08_RS10470 (QRF08_10470) | 2222973..2223740 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T283964 WP_003410010.1 NZ_CP127276:c2219481-2219137 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|