Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2210245..2210933 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | QRF08_RS10380 | Protein ID | WP_003409958.1 |
Coordinates | 2210245..2210664 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | QRF08_RS10385 | Protein ID | WP_003409968.1 |
Coordinates | 2210673..2210933 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS10360 (QRF08_10360) | 2205740..2206588 | + | 849 | WP_003901306.1 | class I SAM-dependent methyltransferase | - |
QRF08_RS10365 (QRF08_10365) | 2206551..2207996 | - | 1446 | WP_003899115.1 | APC family permease | - |
QRF08_RS10370 (QRF08_10370) | 2208175..2208861 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
QRF08_RS10375 (QRF08_10375) | 2209052..2210020 | - | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
QRF08_RS10380 (QRF08_10380) | 2210245..2210664 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF08_RS10385 (QRF08_10385) | 2210673..2210933 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF08_RS10390 (QRF08_10390) | 2211076..2212752 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
QRF08_RS10395 (QRF08_10395) | 2212740..2213393 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
QRF08_RS10400 (QRF08_10400) | 2213508..2213738 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
QRF08_RS10405 (QRF08_10405) | 2213823..2214734 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
QRF08_RS10410 (QRF08_10410) | 2214843..2215442 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T283962 WP_003409958.1 NZ_CP127276:c2210664-2210245 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |