Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2188513..2189057 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TLU9 |
| Locus tag | QRF08_RS10260 | Protein ID | WP_003409896.1 |
| Coordinates | 2188513..2188809 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P67299 |
| Locus tag | QRF08_RS10265 | Protein ID | WP_003409899.1 |
| Coordinates | 2188806..2189057 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS10205 (QRF08_10205) | 2183546..2183896 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| QRF08_RS10210 (QRF08_10210) | 2183907..2184809 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| QRF08_RS10215 (QRF08_10215) | 2184830..2185021 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| QRF08_RS10220 (QRF08_10220) | 2185022..2185318 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| QRF08_RS10225 (QRF08_10225) | 2185558..2185773 | + | 216 | WP_003409878.1 | antitoxin | - |
| QRF08_RS10230 (QRF08_10230) | 2185770..2186081 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF08_RS10235 (QRF08_10235) | 2186055..2186576 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| QRF08_RS10240 (QRF08_10240) | 2186551..2186928 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | - |
| QRF08_RS10245 (QRF08_10245) | 2186970..2187419 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | - |
| QRF08_RS10250 (QRF08_10250) | 2187416..2187961 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| QRF08_RS10255 (QRF08_10255) | 2187850..2188464 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| QRF08_RS10260 (QRF08_10260) | 2188513..2188809 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRF08_RS10265 (QRF08_10265) | 2188806..2189057 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| QRF08_RS10270 (QRF08_10270) | 2189044..2189538 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| QRF08_RS10275 (QRF08_10275) | 2189698..2190105 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF08_RS10280 (QRF08_10280) | 2190109..2190381 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRF08_RS10285 (QRF08_10285) | 2190414..2191634 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
| QRF08_RS10290 (QRF08_10290) | 2192532..2193329 | + | 798 | WP_003899101.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11268.64 Da Isoelectric Point: 6.8604
>T283961 WP_003409896.1 NZ_CP127276:c2188809-2188513 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TLU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUZ2 |