Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2179476..2180179 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | QRF08_RS10170 | Protein ID | WP_003409778.1 |
| Coordinates | 2179476..2179805 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | QRF08_RS10175 | Protein ID | WP_003409780.1 |
| Coordinates | 2179802..2180179 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS10150 (QRF08_10150) | 2175859..2176929 | + | 1071 | WP_003902252.1 | epoxide hydrolase EphB | - |
| QRF08_RS10155 (QRF08_10155) | 2176926..2177441 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
| QRF08_RS10160 (QRF08_10160) | 2177438..2178499 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| QRF08_RS10165 (QRF08_10165) | 2178496..2179266 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| QRF08_RS10170 (QRF08_10170) | 2179476..2179805 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QRF08_RS10175 (QRF08_10175) | 2179802..2180179 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| QRF08_RS10180 (QRF08_10180) | 2180176..2180766 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
| QRF08_RS10185 (QRF08_10185) | 2180821..2182185 | + | 1365 | WP_003910878.1 | HNH endonuclease signature motif containing protein | - |
| QRF08_RS10190 (QRF08_10190) | 2182340..2182792 | - | 453 | WP_003899095.1 | lipoprotein | - |
| QRF08_RS10195 (QRF08_10195) | 2182856..2183257 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| QRF08_RS10200 (QRF08_10200) | 2183250..2183432 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| QRF08_RS10205 (QRF08_10205) | 2183546..2183896 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| QRF08_RS10210 (QRF08_10210) | 2183907..2184809 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| QRF08_RS10215 (QRF08_10215) | 2184830..2185021 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T283959 WP_003409778.1 NZ_CP127276:c2179805-2179476 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT283959 WP_003409780.1 NZ_CP127276:c2180179-2179802 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|