Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1937029..1937642 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QRF08_RS09050 | Protein ID | WP_003910864.1 |
| Coordinates | 1937029..1937418 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | QRF08_RS09055 | Protein ID | WP_003408469.1 |
| Coordinates | 1937415..1937642 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS09015 (QRF08_09015) | 1932658..1933572 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
| QRF08_RS09020 (QRF08_09020) | 1933575..1934405 | + | 831 | WP_003408448.1 | cyclase family protein | - |
| QRF08_RS09025 (QRF08_09025) | 1934405..1934755 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
| QRF08_RS09030 (QRF08_09030) | 1934808..1935626 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
| QRF08_RS09035 (QRF08_09035) | 1935640..1936419 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| QRF08_RS09045 (QRF08_09045) | 1936850..1936981 | + | 132 | Protein_1784 | IS3 family transposase | - |
| QRF08_RS09050 (QRF08_09050) | 1937029..1937418 | - | 390 | WP_003910864.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF08_RS09055 (QRF08_09055) | 1937415..1937642 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| QRF08_RS09060 (QRF08_09060) | 1937860..1939344 | + | 1485 | WP_003408473.1 | biotin carboxylase | - |
| QRF08_RS09065 (QRF08_09065) | 1939341..1940588 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
| QRF08_RS09070 (QRF08_09070) | 1940631..1941050 | - | 420 | WP_003408483.1 | hypothetical protein | - |
| QRF08_RS09075 (QRF08_09075) | 1941040..1941750 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13837.02 Da Isoelectric Point: 7.4232
>T283957 WP_003910864.1 NZ_CP127276:c1937418-1937029 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|