Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1763992..1764605 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | QRF08_RS08300 | Protein ID | WP_003407786.1 |
Coordinates | 1764201..1764605 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | QRF08_RS08295 | Protein ID | WP_009935474.1 |
Coordinates | 1763992..1764195 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS08265 (QRF08_08265) | 1759397..1759777 | + | 381 | WP_003407768.1 | fumarate reductase subunit C | - |
QRF08_RS08270 (QRF08_08270) | 1759774..1760151 | + | 378 | WP_003407771.1 | fumarate reductase subunit FrdD | - |
QRF08_RS08275 (QRF08_08275) | 1760219..1760827 | + | 609 | WP_003407773.1 | TetR/AcrR family transcriptional regulator | - |
QRF08_RS08280 (QRF08_08280) | 1761011..1762159 | + | 1149 | Protein_1633 | MMPL family transporter | - |
QRF08_RS08285 (QRF08_08285) | 1762169..1762615 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
QRF08_RS08290 (QRF08_08290) | 1762650..1763939 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
QRF08_RS08295 (QRF08_08295) | 1763992..1764195 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF08_RS08300 (QRF08_08300) | 1764201..1764605 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
QRF08_RS08305 (QRF08_08305) | 1764622..1766364 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
QRF08_RS08310 (QRF08_08310) | 1766357..1768654 | - | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T283956 WP_003407786.1 NZ_CP127276:1764201-1764605 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|