Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1685493..1686109 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | QRF08_RS07955 | Protein ID | WP_003407593.1 |
Coordinates | 1685792..1686109 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | QRF08_RS07950 | Protein ID | WP_003900349.1 |
Coordinates | 1685493..1685795 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS07940 (QRF08_07940) | 1681379..1683226 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
QRF08_RS07945 (QRF08_07945) | 1683227..1685479 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
QRF08_RS07950 (QRF08_07950) | 1685493..1685795 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
QRF08_RS07955 (QRF08_07955) | 1685792..1686109 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
QRF08_RS07960 (QRF08_07960) | 1686106..1687110 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
QRF08_RS07965 (QRF08_07965) | 1687163..1688452 | + | 1290 | WP_003902090.1 | serine hydrolase domain-containing protein | - |
QRF08_RS07970 (QRF08_07970) | 1688525..1689250 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
QRF08_RS07975 (QRF08_07975) | 1689356..1689568 | - | 213 | WP_003898900.1 | dodecin family protein | - |
QRF08_RS07980 (QRF08_07980) | 1689629..1690027 | + | 399 | WP_003900351.1 | hypothetical protein | - |
QRF08_RS07985 (QRF08_07985) | 1690072..1691100 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T283955 WP_003407593.1 NZ_CP127276:1685792-1686109 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|