Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1238638..1239206 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag QRF08_RS05955 Protein ID WP_003405865.1
Coordinates 1238832..1239206 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag QRF08_RS05950 Protein ID WP_003405863.1
Coordinates 1238638..1238835 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS05930 (QRF08_05930) 1234679..1235317 - 639 WP_003898730.1 lipid droplet-associated protein -
QRF08_RS05935 (QRF08_05935) 1235407..1236414 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
QRF08_RS05940 (QRF08_05940) 1236431..1237414 - 984 WP_003898731.1 hypothetical protein -
QRF08_RS05945 (QRF08_05945) 1237477..1238550 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
QRF08_RS05950 (QRF08_05950) 1238638..1238835 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRF08_RS05955 (QRF08_05955) 1238832..1239206 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF08_RS05960 (QRF08_05960) 1239409..1240107 + 699 WP_003898733.1 hypothetical protein -
QRF08_RS05965 (QRF08_05965) 1240225..1240410 + 186 WP_003901093.1 hypothetical protein -
QRF08_RS05970 (QRF08_05970) 1240337..1240612 - 276 WP_003405867.1 hypothetical protein -
QRF08_RS05975 (QRF08_05975) 1240855..1241178 + 324 WP_003405871.1 putative quinol monooxygenase -
QRF08_RS05980 (QRF08_05980) 1241193..1241891 - 699 WP_031646953.1 hypothetical protein -
QRF08_RS05985 (QRF08_05985) 1241925..1242134 + 210 WP_003911400.1 hypothetical protein -
QRF08_RS05990 (QRF08_05990) 1242086..1242856 - 771 Protein_1180 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T283950 WP_003405865.1 NZ_CP127276:1238832-1239206 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT283950 WP_003405863.1 NZ_CP127276:1238638-1238835 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References