Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1229882..1230513 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | QRF08_RS05900 | Protein ID | WP_003405820.1 |
Coordinates | 1229882..1230193 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | QRF08_RS05905 | Protein ID | WP_003405836.1 |
Coordinates | 1230193..1230513 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS05880 (QRF08_05880) | 1225363..1226787 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
QRF08_RS05885 (QRF08_05885) | 1226818..1227906 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
QRF08_RS05890 (QRF08_05890) | 1227962..1228606 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
QRF08_RS05895 (QRF08_05895) | 1228613..1229770 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
QRF08_RS05900 (QRF08_05900) | 1229882..1230193 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
QRF08_RS05905 (QRF08_05905) | 1230193..1230513 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
QRF08_RS05910 (QRF08_05910) | 1230523..1232059 | + | 1537 | Protein_1164 | carboxylesterase/lipase family protein | - |
QRF08_RS05915 (QRF08_05915) | 1232066..1233178 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
QRF08_RS05920 (QRF08_05920) | 1233188..1233445 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
QRF08_RS05925 (QRF08_05925) | 1233435..1234682 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
QRF08_RS05930 (QRF08_05930) | 1234679..1235317 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T283949 WP_003405820.1 NZ_CP127276:c1230193-1229882 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |