Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 710004..710629 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | QRF08_RS03255 | Protein ID | WP_003403218.1 |
Coordinates | 710228..710629 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | QRF08_RS03250 | Protein ID | WP_003403213.1 |
Coordinates | 710004..710231 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS03225 (QRF08_03225) | 705183..705404 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
QRF08_RS03230 (QRF08_03230) | 705546..706151 | + | 606 | WP_003898526.1 | hypothetical protein | - |
QRF08_RS03235 (QRF08_03235) | 706170..708737 | - | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
QRF08_RS03240 (QRF08_03240) | 708821..709570 | + | 750 | WP_003898528.1 | hypothetical protein | - |
QRF08_RS03245 (QRF08_03245) | 709567..709809 | + | 243 | WP_003403210.1 | hypothetical protein | - |
QRF08_RS03250 (QRF08_03250) | 710004..710231 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
QRF08_RS03255 (QRF08_03255) | 710228..710629 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
QRF08_RS03260 (QRF08_03260) | 710758..710841 | + | 84 | Protein_646 | galactose-1-phosphate uridylyltransferase | - |
QRF08_RS03265 (QRF08_03265) | 710860..711941 | + | 1082 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
QRF08_RS03270 (QRF08_03270) | 711938..713029 | + | 1092 | WP_003900977.1 | galactokinase | - |
QRF08_RS03275 (QRF08_03275) | 713424..714488 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
QRF08_RS03280 (QRF08_03280) | 714592..715539 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T283938 WP_003403218.1 NZ_CP127276:710228-710629 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |