Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3683030..3683704 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag QRF09_RS17465 Protein ID WP_003417282.1
Coordinates 3683030..3683458 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag QRF09_RS17470 Protein ID WP_003417286.1
Coordinates 3683462..3683704 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS17440 (QRF09_17440) 3678852..3679253 - 402 WP_003417264.1 cytidine deaminase -
QRF09_RS17445 (QRF09_17445) 3679490..3679828 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
QRF09_RS17450 (QRF09_17450) 3679825..3680259 + 435 WP_003902441.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
QRF09_RS17455 (QRF09_17455) 3680388..3682160 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
QRF09_RS17460 (QRF09_17460) 3682160..3682951 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
QRF09_RS17465 (QRF09_17465) 3683030..3683458 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF09_RS17470 (QRF09_17470) 3683462..3683704 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
QRF09_RS17475 (QRF09_17475) 3683826..3684440 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
QRF09_RS17480 (QRF09_17480) 3684437..3685102 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
QRF09_RS17485 (QRF09_17485) 3685103..3685636 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
QRF09_RS17490 (QRF09_17490) 3685633..3685767 - 135 Protein_3454 4a-hydroxytetrahydrobiopterin dehydratase -
QRF09_RS17495 (QRF09_17495) 3685821..3687082 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T283924 WP_003417282.1 NZ_CP127275:c3683458-3683030 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT283924 WP_003417286.1 NZ_CP127275:c3683704-3683462 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References