Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3158536..3159223 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | QRF09_RS15090 | Protein ID | WP_003414624.1 |
Coordinates | 3158780..3159223 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | QRF09_RS15085 | Protein ID | WP_003414620.1 |
Coordinates | 3158536..3158793 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS15065 (QRF09_15065) | 3153856..3154710 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
QRF09_RS15070 (QRF09_15070) | 3154766..3155929 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
QRF09_RS15075 (QRF09_15075) | 3155946..3157160 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
QRF09_RS15080 (QRF09_15080) | 3157168..3158409 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
QRF09_RS15085 (QRF09_15085) | 3158536..3158793 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QRF09_RS15090 (QRF09_15090) | 3158780..3159223 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF09_RS15095 (QRF09_15095) | 3159303..3159965 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
QRF09_RS15100 (QRF09_15100) | 3160061..3160252 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
QRF09_RS15105 (QRF09_15105) | 3160584..3162332 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
QRF09_RS15110 (QRF09_15110) | 3162428..3163009 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
QRF09_RS15115 (QRF09_15115) | 3163109..3163375 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T283922 WP_003414624.1 NZ_CP127275:3158780-3159223 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|