Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3049279..3049958 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | QRF09_RS14500 | Protein ID | WP_003414059.1 |
Coordinates | 3049279..3049695 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | QRF09_RS14505 | Protein ID | WP_003414061.1 |
Coordinates | 3049692..3049958 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS14480 (QRF09_14480) | 3045331..3046233 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QRF09_RS14485 (QRF09_14485) | 3046302..3047054 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
QRF09_RS14490 (QRF09_14490) | 3047298..3047573 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
QRF09_RS14495 (QRF09_14495) | 3047570..3049192 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
QRF09_RS14500 (QRF09_14500) | 3049279..3049695 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
QRF09_RS14505 (QRF09_14505) | 3049692..3049958 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF09_RS14510 (QRF09_14510) | 3049984..3050379 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF09_RS14515 (QRF09_14515) | 3050376..3050645 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF09_RS14520 (QRF09_14520) | 3050655..3051749 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
QRF09_RS14525 (QRF09_14525) | 3051746..3052165 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
QRF09_RS14530 (QRF09_14530) | 3052164..3052238 | + | 75 | Protein_2867 | hypothetical protein | - |
QRF09_RS14535 (QRF09_14535) | 3052239..3052718 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
QRF09_RS14540 (QRF09_14540) | 3052789..3053589 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
QRF09_RS14545 (QRF09_14545) | 3053745..3054482 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T283916 WP_003414059.1 NZ_CP127275:c3049695-3049279 [Mycobacterium tuberculosis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|