Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2848836..2849473 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | QRF09_RS13415 | Protein ID | WP_003413180.1 |
Coordinates | 2848836..2849231 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | QRF09_RS13420 | Protein ID | WP_003413183.1 |
Coordinates | 2849228..2849473 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS13375 (QRF09_13375) | 2844239..2845450 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
QRF09_RS13380 (QRF09_13380) | 2845577..2846236 | + | 660 | WP_285978957.1 | LppA family lipoprotein | - |
QRF09_RS13385 (QRF09_13385) | 2846233..2846895 | + | 663 | WP_285978958.1 | LppA family lipoprotein | - |
QRF09_RS13390 (QRF09_13390) | 2846892..2847170 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF09_RS13395 (QRF09_13395) | 2847263..2847676 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
QRF09_RS13400 (QRF09_13400) | 2847715..2847972 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | - |
QRF09_RS13405 (QRF09_13405) | 2847969..2848346 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF09_RS13410 (QRF09_13410) | 2848362..2848736 | - | 375 | WP_003413177.1 | hypothetical protein | - |
QRF09_RS13415 (QRF09_13415) | 2848836..2849231 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
QRF09_RS13420 (QRF09_13420) | 2849228..2849473 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
QRF09_RS13425 (QRF09_13425) | 2849884..2850303 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
QRF09_RS13430 (QRF09_13430) | 2850315..2851124 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
QRF09_RS13435 (QRF09_13435) | 2851121..2852374 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
QRF09_RS13440 (QRF09_13440) | 2852367..2852879 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T283913 WP_003413180.1 NZ_CP127275:c2849231-2848836 [Mycobacterium tuberculosis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |