Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2847263..2847972 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag QRF09_RS13395 Protein ID WP_003413164.1
Coordinates 2847263..2847676 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag QRF09_RS13400 Protein ID WP_003413167.1
Coordinates 2847715..2847972 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS13365 (QRF09_13365) 2842316..2843521 - 1206 WP_003413027.1 chorismate synthase -
QRF09_RS13370 (QRF09_13370) 2843629..2843943 + 315 WP_009937839.1 hypothetical protein -
QRF09_RS13375 (QRF09_13375) 2844239..2845450 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
QRF09_RS13380 (QRF09_13380) 2845577..2846236 + 660 WP_285978957.1 LppA family lipoprotein -
QRF09_RS13385 (QRF09_13385) 2846233..2846895 + 663 WP_285978958.1 LppA family lipoprotein -
QRF09_RS13390 (QRF09_13390) 2846892..2847170 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
QRF09_RS13395 (QRF09_13395) 2847263..2847676 + 414 WP_003413164.1 PIN domain nuclease Toxin
QRF09_RS13400 (QRF09_13400) 2847715..2847972 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
QRF09_RS13405 (QRF09_13405) 2847969..2848346 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
QRF09_RS13410 (QRF09_13410) 2848362..2848736 - 375 WP_003413177.1 hypothetical protein -
QRF09_RS13415 (QRF09_13415) 2848836..2849231 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
QRF09_RS13420 (QRF09_13420) 2849228..2849473 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
QRF09_RS13425 (QRF09_13425) 2849884..2850303 - 420 WP_003413190.1 A24 family peptidase -
QRF09_RS13430 (QRF09_13430) 2850315..2851124 - 810 WP_003413193.1 shikimate dehydrogenase -
QRF09_RS13435 (QRF09_13435) 2851121..2852374 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
QRF09_RS13440 (QRF09_13440) 2852367..2852879 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T283911 WP_003413164.1 NZ_CP127275:2847263-2847676 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT283911 WP_003413167.1 NZ_CP127275:2847715-2847972 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References