Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2300853..2301489 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | QRF09_RS10790 | Protein ID | WP_003410654.1 |
Coordinates | 2301079..2301489 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | QRF09_RS10785 | Protein ID | WP_003410651.1 |
Coordinates | 2300853..2301086 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10770 (QRF09_10770) | 2296310..2296702 | + | 393 | WP_229303073.1 | metal ABC transporter permease | - |
QRF09_RS10775 (QRF09_10775) | 2296703..2297107 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
QRF09_RS10780 (QRF09_10780) | 2297191..2300775 | - | 3585 | WP_003910889.1 | cobaltochelatase subunit CobN | - |
QRF09_RS10785 (QRF09_10785) | 2300853..2301086 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
QRF09_RS10790 (QRF09_10790) | 2301079..2301489 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
QRF09_RS10795 (QRF09_10795) | 2301473..2302564 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
QRF09_RS10800 (QRF09_10800) | 2302574..2303200 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
QRF09_RS10805 (QRF09_10805) | 2303197..2304723 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
QRF09_RS10810 (QRF09_10810) | 2304669..2305892 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T283906 WP_003410654.1 NZ_CP127275:2301079-2301489 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|