Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2238067..2238693 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | QRF09_RS10510 | Protein ID | WP_003410075.1 |
Coordinates | 2238295..2238693 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | QRF09_RS10505 | Protein ID | WP_003911750.1 |
Coordinates | 2238067..2238294 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10495 (QRF09_10495) | 2236106..2236450 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
QRF09_RS10500 (QRF09_10500) | 2236639..2237808 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
QRF09_RS10505 (QRF09_10505) | 2238067..2238294 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF09_RS10510 (QRF09_10510) | 2238295..2238693 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
QRF09_RS10515 (QRF09_10515) | 2238876..2239307 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRF09_RS10520 (QRF09_10520) | 2239408..2239842 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
QRF09_RS10525 (QRF09_10525) | 2240279..2240458 | - | 180 | Protein_2080 | hypothetical protein | - |
QRF09_RS10530 (QRF09_10530) | 2240546..2241166 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
QRF09_RS10535 (QRF09_10535) | 2241120..2241710 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
QRF09_RS10540 (QRF09_10540) | 2241838..2243094 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T283904 WP_003410075.1 NZ_CP127275:2238295-2238693 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|