Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2214327..2214913 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | QRF09_RS10405 | Protein ID | WP_003410010.1 |
Coordinates | 2214327..2214671 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | QRF09_RS10410 | Protein ID | WP_003410014.1 |
Coordinates | 2214665..2214913 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10370 (QRF09_10370) | 2210033..2210632 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
QRF09_RS10375 (QRF09_10375) | 2211048..2211476 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
QRF09_RS10380 (QRF09_10380) | 2211702..2212241 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
QRF09_RS10385 (QRF09_10385) | 2212761..2213321 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
QRF09_RS10390 (QRF09_10390) | 2213318..2213659 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
QRF09_RS10395 (QRF09_10395) | 2213745..2214002 | + | 258 | WP_003410006.1 | hypothetical protein | - |
QRF09_RS10400 (QRF09_10400) | 2213903..2214238 | - | 336 | WP_003410009.1 | dehydrogenase | - |
QRF09_RS10405 (QRF09_10405) | 2214327..2214671 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
QRF09_RS10410 (QRF09_10410) | 2214665..2214913 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QRF09_RS10415 (QRF09_10415) | 2215013..2217328 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
QRF09_RS10420 (QRF09_10420) | 2217325..2217597 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
QRF09_RS10425 (QRF09_10425) | 2217650..2218006 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
QRF09_RS10430 (QRF09_10430) | 2218163..2218930 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T283903 WP_003410010.1 NZ_CP127275:c2214671-2214327 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|