Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2175006..2175709 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | QRF09_RS10130 | Protein ID | WP_003409778.1 |
Coordinates | 2175006..2175335 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | QRF09_RS10135 | Protein ID | WP_003409780.1 |
Coordinates | 2175332..2175709 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS10110 (QRF09_10110) | 2171389..2172459 | + | 1071 | WP_003902252.1 | epoxide hydrolase EphB | - |
QRF09_RS10115 (QRF09_10115) | 2172456..2172971 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
QRF09_RS10120 (QRF09_10120) | 2172968..2174029 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
QRF09_RS10125 (QRF09_10125) | 2174026..2174796 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
QRF09_RS10130 (QRF09_10130) | 2175006..2175335 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QRF09_RS10135 (QRF09_10135) | 2175332..2175709 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
QRF09_RS10140 (QRF09_10140) | 2175706..2176296 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
QRF09_RS10145 (QRF09_10145) | 2176351..2177715 | + | 1365 | WP_003910878.1 | HNH endonuclease signature motif containing protein | - |
QRF09_RS10150 (QRF09_10150) | 2177870..2178322 | - | 453 | WP_003899095.1 | lipoprotein | - |
QRF09_RS10155 (QRF09_10155) | 2178386..2178787 | + | 402 | WP_003409869.1 | hypothetical protein | - |
QRF09_RS10160 (QRF09_10160) | 2178780..2178962 | - | 183 | WP_003409870.1 | hypothetical protein | - |
QRF09_RS10165 (QRF09_10165) | 2179076..2179426 | - | 351 | WP_003409871.1 | hypothetical protein | - |
QRF09_RS10170 (QRF09_10170) | 2179437..2180339 | - | 903 | WP_003899097.1 | hypothetical protein | - |
QRF09_RS10175 (QRF09_10175) | 2180360..2180551 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T283898 WP_003409778.1 NZ_CP127275:c2175335-2175006 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT283898 WP_003409780.1 NZ_CP127275:c2175709-2175332 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|