Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1934073..1934686 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRF09_RS09025 | Protein ID | WP_003910864.1 |
Coordinates | 1934073..1934462 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | QRF09_RS09030 | Protein ID | WP_003408469.1 |
Coordinates | 1934459..1934686 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS08990 (QRF09_08990) | 1929702..1930616 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
QRF09_RS08995 (QRF09_08995) | 1930619..1931449 | + | 831 | WP_003408448.1 | cyclase family protein | - |
QRF09_RS09000 (QRF09_09000) | 1931449..1931799 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
QRF09_RS09005 (QRF09_09005) | 1931852..1932670 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
QRF09_RS09010 (QRF09_09010) | 1932684..1933463 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
QRF09_RS09020 (QRF09_09020) | 1933894..1934025 | + | 132 | Protein_1779 | IS3 family transposase | - |
QRF09_RS09025 (QRF09_09025) | 1934073..1934462 | - | 390 | WP_003910864.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF09_RS09030 (QRF09_09030) | 1934459..1934686 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
QRF09_RS09035 (QRF09_09035) | 1934904..1936388 | + | 1485 | WP_003408473.1 | biotin carboxylase | - |
QRF09_RS09040 (QRF09_09040) | 1936385..1937632 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
QRF09_RS09045 (QRF09_09045) | 1937675..1938094 | - | 420 | WP_003408483.1 | hypothetical protein | - |
QRF09_RS09050 (QRF09_09050) | 1938084..1938794 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13837.02 Da Isoelectric Point: 7.4232
>T283896 WP_003910864.1 NZ_CP127275:c1934462-1934073 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|