Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1235729..1236297 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag QRF09_RS05930 Protein ID WP_003405865.1
Coordinates 1235923..1236297 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag QRF09_RS05925 Protein ID WP_003405863.1
Coordinates 1235729..1235926 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS05905 (QRF09_05905) 1231770..1232408 - 639 WP_003898730.1 lipid droplet-associated protein -
QRF09_RS05910 (QRF09_05910) 1232498..1233505 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
QRF09_RS05915 (QRF09_05915) 1233522..1234505 - 984 WP_003898731.1 hypothetical protein -
QRF09_RS05920 (QRF09_05920) 1234568..1235641 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
QRF09_RS05925 (QRF09_05925) 1235729..1235926 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRF09_RS05930 (QRF09_05930) 1235923..1236297 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF09_RS05935 (QRF09_05935) 1236500..1237198 + 699 WP_003898733.1 hypothetical protein -
QRF09_RS05940 (QRF09_05940) 1237316..1237501 + 186 WP_003901093.1 hypothetical protein -
QRF09_RS05945 (QRF09_05945) 1237428..1237703 - 276 WP_003405867.1 hypothetical protein -
QRF09_RS05950 (QRF09_05950) 1237946..1238269 + 324 WP_003405871.1 putative quinol monooxygenase -
QRF09_RS05955 (QRF09_05955) 1238284..1238982 - 699 WP_031646953.1 hypothetical protein -
QRF09_RS05960 (QRF09_05960) 1239016..1239225 + 210 WP_003911400.1 hypothetical protein -
QRF09_RS05965 (QRF09_05965) 1239177..1239947 - 771 Protein_1175 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T283889 WP_003405865.1 NZ_CP127275:1235923-1236297 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT283889 WP_003405863.1 NZ_CP127275:1235729-1235926 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References