Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 751852..752540 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | QRF09_RS03475 | Protein ID | WP_003403386.1 |
Coordinates | 751852..752289 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O06777 |
Locus tag | QRF09_RS03480 | Protein ID | WP_003911263.1 |
Coordinates | 752286..752540 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS03445 (QRF09_03445) | 748103..749113 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
QRF09_RS03450 (QRF09_03450) | 749501..749884 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
QRF09_RS03455 (QRF09_03455) | 749979..750134 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF09_RS03460 (QRF09_03460) | 750210..750926 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
QRF09_RS03465 (QRF09_03465) | 751202..751510 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
QRF09_RS03470 (QRF09_03470) | 751497..751742 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
QRF09_RS03475 (QRF09_03475) | 751852..752289 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF09_RS03480 (QRF09_03480) | 752286..752540 | - | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
QRF09_RS03485 (QRF09_03485) | 752654..755017 | + | 2364 | WP_003901895.1 | arylsulfatase AtsD | - |
QRF09_RS03490 (QRF09_03490) | 755080..755406 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF09_RS03495 (QRF09_03495) | 755318..755656 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
QRF09_RS03500 (QRF09_03500) | 755653..755826 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T283883 WP_003403386.1 NZ_CP127275:c752289-751852 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JQG1 |