Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 707299..707924 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | QRF09_RS03230 | Protein ID | WP_003403218.1 |
Coordinates | 707523..707924 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | QRF09_RS03225 | Protein ID | WP_003403213.1 |
Coordinates | 707299..707526 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS03200 (QRF09_03200) | 702478..702699 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
QRF09_RS03205 (QRF09_03205) | 702841..703446 | + | 606 | WP_003898526.1 | hypothetical protein | - |
QRF09_RS03210 (QRF09_03210) | 703465..706032 | - | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
QRF09_RS03215 (QRF09_03215) | 706116..706865 | + | 750 | WP_003898528.1 | hypothetical protein | - |
QRF09_RS03220 (QRF09_03220) | 706862..707104 | + | 243 | WP_003403210.1 | hypothetical protein | - |
QRF09_RS03225 (QRF09_03225) | 707299..707526 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
QRF09_RS03230 (QRF09_03230) | 707523..707924 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
QRF09_RS03235 (QRF09_03235) | 708053..708136 | + | 84 | Protein_641 | galactose-1-phosphate uridylyltransferase | - |
QRF09_RS03240 (QRF09_03240) | 708155..709236 | + | 1082 | Protein_642 | galactose-1-phosphate uridylyltransferase | - |
QRF09_RS03245 (QRF09_03245) | 709233..710324 | + | 1092 | WP_003900977.1 | galactokinase | - |
QRF09_RS03250 (QRF09_03250) | 710719..711783 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
QRF09_RS03255 (QRF09_03255) | 711887..712834 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T283877 WP_003403218.1 NZ_CP127275:707523-707924 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |