Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 693671..694317 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag QRF09_RS03125 Protein ID WP_003403137.1
Coordinates 693671..694084 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag QRF09_RS03130 Protein ID WP_003403139.1
Coordinates 694081..694317 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS03105 (QRF09_03105) 689754..691304 + 1551 WP_003905349.1 MCE family protein -
QRF09_RS03110 (QRF09_03110) 691356..691748 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
QRF09_RS03115 (QRF09_03115) 691745..692002 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
QRF09_RS03120 (QRF09_03120) 692185..693420 - 1236 WP_003403128.1 ATP-binding protein -
QRF09_RS03125 (QRF09_03125) 693671..694084 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF09_RS03130 (QRF09_03130) 694081..694317 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
QRF09_RS03135 (QRF09_03135) 694421..694927 - 507 WP_003900973.1 two component system sensor kinase HK1 -
QRF09_RS03140 (QRF09_03140) 695041..695571 - 531 WP_003917320.1 two component system sensor kinase HK2 -
QRF09_RS03145 (QRF09_03145) 695555..696250 - 696 WP_003918099.1 two-component system response regulator TcrA -
QRF09_RS03150 (QRF09_03150) 696373..696684 + 312 WP_003403164.1 hypothetical protein -
QRF09_RS03155 (QRF09_03155) 696756..697706 + 951 WP_003900184.1 DUF1259 domain-containing protein -
QRF09_RS03160 (QRF09_03160) 697947..698531 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
QRF09_RS03165 (QRF09_03165) 698533..699243 + 711 Protein_627 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T283875 WP_003403137.1 NZ_CP127275:c694084-693671 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT283875 WP_003403139.1 NZ_CP127275:c694317-694081 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References