Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3691527..3692201 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag QRF10_RS17505 Protein ID WP_003417282.1
Coordinates 3691527..3691955 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag QRF10_RS17510 Protein ID WP_003417286.1
Coordinates 3691959..3692201 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS17480 (QRF10_17480) 3687349..3687750 - 402 WP_003417264.1 cytidine deaminase -
QRF10_RS17485 (QRF10_17485) 3687987..3688325 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
QRF10_RS17490 (QRF10_17490) 3688322..3688756 + 435 WP_003913036.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
QRF10_RS17495 (QRF10_17495) 3688885..3690657 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
QRF10_RS17500 (QRF10_17500) 3690657..3691448 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
QRF10_RS17505 (QRF10_17505) 3691527..3691955 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF10_RS17510 (QRF10_17510) 3691959..3692201 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
QRF10_RS17515 (QRF10_17515) 3692323..3692937 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
QRF10_RS17520 (QRF10_17520) 3692934..3693599 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
QRF10_RS17525 (QRF10_17525) 3693600..3694133 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
QRF10_RS17530 (QRF10_17530) 3694130..3694264 - 135 Protein_3462 4a-hydroxytetrahydrobiopterin dehydratase -
QRF10_RS17535 (QRF10_17535) 3694318..3695579 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T283863 WP_003417282.1 NZ_CP127274:c3691955-3691527 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT283863 WP_003417286.1 NZ_CP127274:c3692201-3691959 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References