Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3691527..3692201 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF52 |
| Locus tag | QRF10_RS17505 | Protein ID | WP_003417282.1 |
| Coordinates | 3691527..3691955 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TI59 |
| Locus tag | QRF10_RS17510 | Protein ID | WP_003417286.1 |
| Coordinates | 3691959..3692201 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS17480 (QRF10_17480) | 3687349..3687750 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
| QRF10_RS17485 (QRF10_17485) | 3687987..3688325 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
| QRF10_RS17490 (QRF10_17490) | 3688322..3688756 | + | 435 | WP_003913036.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
| QRF10_RS17495 (QRF10_17495) | 3688885..3690657 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
| QRF10_RS17500 (QRF10_17500) | 3690657..3691448 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
| QRF10_RS17505 (QRF10_17505) | 3691527..3691955 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF10_RS17510 (QRF10_17510) | 3691959..3692201 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
| QRF10_RS17515 (QRF10_17515) | 3692323..3692937 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
| QRF10_RS17520 (QRF10_17520) | 3692934..3693599 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
| QRF10_RS17525 (QRF10_17525) | 3693600..3694133 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| QRF10_RS17530 (QRF10_17530) | 3694130..3694264 | - | 135 | Protein_3462 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| QRF10_RS17535 (QRF10_17535) | 3694318..3695579 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T283863 WP_003417282.1 NZ_CP127274:c3691955-3691527 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBL0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TI59 |