Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3161422..3161970 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | QRF10_RS15100 | Protein ID | WP_003414602.1 |
Coordinates | 3161707..3161970 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | QRF10_RS15095 | Protein ID | WP_003414599.1 |
Coordinates | 3161422..3161703 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS15070 (QRF10_15070) | 3157045..3157902 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
QRF10_RS15075 (QRF10_15075) | 3157944..3158528 | - | 585 | WP_003899514.1 | DUF1707 domain-containing protein | - |
QRF10_RS15080 (QRF10_15080) | 3158632..3158880 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
QRF10_RS15085 (QRF10_15085) | 3158877..3159257 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS15090 (QRF10_15090) | 3159339..3161150 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
QRF10_RS15095 (QRF10_15095) | 3161422..3161703 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
QRF10_RS15100 (QRF10_15100) | 3161707..3161970 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF10_RS15105 (QRF10_15105) | 3162343..3163197 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
QRF10_RS15110 (QRF10_15110) | 3163253..3164416 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
QRF10_RS15115 (QRF10_15115) | 3164433..3165647 | - | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
QRF10_RS15120 (QRF10_15120) | 3165655..3166896 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T283860 WP_003414602.1 NZ_CP127274:3161707-3161970 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O | |
AlphaFold DB | A0A7U4BWP8 |