Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3094101..3094671 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | QRF10_RS14755 | Protein ID | WP_003414166.1 |
Coordinates | 3094101..3094457 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | QRF10_RS14760 | Protein ID | WP_003901465.1 |
Coordinates | 3094441..3094671 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS14735 (QRF10_14735) | 3089553..3091241 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
QRF10_RS14740 (QRF10_14740) | 3091245..3091571 | - | 327 | WP_003414157.1 | hypothetical protein | - |
QRF10_RS14745 (QRF10_14745) | 3091744..3092331 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
QRF10_RS14750 (QRF10_14750) | 3092350..3093999 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
QRF10_RS14755 (QRF10_14755) | 3094101..3094457 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
QRF10_RS14760 (QRF10_14760) | 3094441..3094671 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
QRF10_RS14765 (QRF10_14765) | 3094714..3095757 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
QRF10_RS14770 (QRF10_14770) | 3095756..3096223 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
QRF10_RS14775 (QRF10_14775) | 3096399..3096653 | - | 255 | WP_003917684.1 | hypothetical protein | - |
QRF10_RS14780 (QRF10_14780) | 3096801..3097205 | + | 405 | WP_009938577.1 | hypothetical protein | - |
QRF10_RS14785 (QRF10_14785) | 3097202..3097393 | + | 192 | WP_003414184.1 | hypothetical protein | - |
QRF10_RS14790 (QRF10_14790) | 3097610..3097870 | + | 261 | Protein_2919 | transposase | - |
QRF10_RS14795 (QRF10_14795) | 3098980..3099237 | + | 258 | WP_003899489.1 | hypothetical protein | - |
QRF10_RS14800 (QRF10_14800) | 3099342..3099653 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T283857 WP_003414166.1 NZ_CP127274:c3094457-3094101 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|