Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3054517..3055204 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | QRF10_RS14535 | Protein ID | WP_003414064.1 |
Coordinates | 3054809..3055204 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | QRF10_RS14530 | Protein ID | WP_003414061.1 |
Coordinates | 3054517..3054783 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS14505 (QRF10_14505) | 3050156..3051058 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QRF10_RS14510 (QRF10_14510) | 3051127..3051879 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
QRF10_RS14515 (QRF10_14515) | 3052123..3052398 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
QRF10_RS14520 (QRF10_14520) | 3052395..3054017 | - | 1623 | WP_003906897.1 | class I SAM-dependent DNA methyltransferase | - |
QRF10_RS14525 (QRF10_14525) | 3054104..3054520 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
QRF10_RS14530 (QRF10_14530) | 3054517..3054783 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF10_RS14535 (QRF10_14535) | 3054809..3055204 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF10_RS14540 (QRF10_14540) | 3055201..3055470 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF10_RS14545 (QRF10_14545) | 3055480..3056574 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
QRF10_RS14550 (QRF10_14550) | 3056571..3056990 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
QRF10_RS14555 (QRF10_14555) | 3056989..3057063 | + | 75 | Protein_2872 | hypothetical protein | - |
QRF10_RS14560 (QRF10_14560) | 3057064..3057543 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
QRF10_RS14565 (QRF10_14565) | 3057614..3058414 | - | 801 | WP_286018039.1 | thymidylate synthase | - |
QRF10_RS14570 (QRF10_14570) | 3058570..3059307 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T283856 WP_003414064.1 NZ_CP127274:c3055204-3054809 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|