Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2914004..2914718 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag QRF10_RS13705 Protein ID WP_003413460.1
Coordinates 2914278..2914718 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag QRF10_RS13700 Protein ID WP_003413456.1
Coordinates 2914004..2914291 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS13665 (QRF10_13665) 2909426..2909671 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF10_RS13670 (QRF10_13670) 2909668..2910072 + 405 WP_003899389.1 type II toxin-antitoxin system VapC family toxin -
QRF10_RS13675 (QRF10_13675) 2910289..2910909 + 621 WP_003912795.1 DUF4178 domain-containing protein -
QRF10_RS13680 (QRF10_13680) 2910920..2911414 + 495 WP_003413444.1 DUF2617 family protein -
QRF10_RS13685 (QRF10_13685) 2911411..2911842 + 432 WP_003899390.1 DUF4247 domain-containing protein -
QRF10_RS13690 (QRF10_13690) 2911867..2912325 + 459 WP_003413451.1 DUF350 domain-containing protein -
QRF10_RS13695 (QRF10_13695) 2912322..2913893 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
QRF10_RS13700 (QRF10_13700) 2914004..2914291 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
QRF10_RS13705 (QRF10_13705) 2914278..2914718 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF10_RS13710 (QRF10_13710) 2914739..2915494 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
QRF10_RS13715 (QRF10_13715) 2915627..2916223 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
QRF10_RS13720 (QRF10_13720) 2916231..2917076 - 846 WP_003413466.1 acyl-CoA thioesterase II -
QRF10_RS13725 (QRF10_13725) 2917105..2918004 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
QRF10_RS13730 (QRF10_13730) 2918132..2918806 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T283853 WP_003413460.1 NZ_CP127274:2914278-2914718 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT283853 WP_003413456.1 NZ_CP127274:2914004-2914291 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References