Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2853661..2854298 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | QRF10_RS13440 | Protein ID | WP_003413180.1 |
Coordinates | 2853661..2854056 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | QRF10_RS13445 | Protein ID | WP_003413183.1 |
Coordinates | 2854053..2854298 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS13400 (QRF10_13400) | 2849064..2850275 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
QRF10_RS13405 (QRF10_13405) | 2850402..2851061 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
QRF10_RS13410 (QRF10_13410) | 2851058..2851720 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
QRF10_RS13415 (QRF10_13415) | 2851717..2851995 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF10_RS13420 (QRF10_13420) | 2852088..2852501 | + | 414 | WP_003912787.1 | PIN domain nuclease | - |
QRF10_RS13425 (QRF10_13425) | 2852540..2852797 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | - |
QRF10_RS13430 (QRF10_13430) | 2852794..2853171 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS13435 (QRF10_13435) | 2853187..2853561 | - | 375 | WP_003413177.1 | hypothetical protein | - |
QRF10_RS13440 (QRF10_13440) | 2853661..2854056 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
QRF10_RS13445 (QRF10_13445) | 2854053..2854298 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
QRF10_RS13450 (QRF10_13450) | 2854709..2855128 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
QRF10_RS13455 (QRF10_13455) | 2855140..2855949 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
QRF10_RS13460 (QRF10_13460) | 2855946..2857199 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
QRF10_RS13465 (QRF10_13465) | 2857192..2857704 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T283852 WP_003413180.1 NZ_CP127274:c2854056-2853661 [Mycobacterium tuberculosis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |