Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2852540..2853171 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag QRF10_RS13430 Protein ID WP_003413174.1
Coordinates 2852794..2853171 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag QRF10_RS13425 Protein ID WP_003413167.1
Coordinates 2852540..2852797 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS13395 (QRF10_13395) 2848454..2848768 + 315 WP_009937839.1 hypothetical protein -
QRF10_RS13400 (QRF10_13400) 2849064..2850275 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
QRF10_RS13405 (QRF10_13405) 2850402..2851061 + 660 WP_003900846.1 LppA family lipoprotein -
QRF10_RS13410 (QRF10_13410) 2851058..2851720 + 663 WP_003900848.1 LppA family lipoprotein -
QRF10_RS13415 (QRF10_13415) 2851717..2851995 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
QRF10_RS13420 (QRF10_13420) 2852088..2852501 + 414 WP_003912787.1 PIN domain nuclease -
QRF10_RS13425 (QRF10_13425) 2852540..2852797 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
QRF10_RS13430 (QRF10_13430) 2852794..2853171 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF10_RS13435 (QRF10_13435) 2853187..2853561 - 375 WP_003413177.1 hypothetical protein -
QRF10_RS13440 (QRF10_13440) 2853661..2854056 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
QRF10_RS13445 (QRF10_13445) 2854053..2854298 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
QRF10_RS13450 (QRF10_13450) 2854709..2855128 - 420 WP_003413190.1 A24 family peptidase -
QRF10_RS13455 (QRF10_13455) 2855140..2855949 - 810 WP_003413193.1 shikimate dehydrogenase -
QRF10_RS13460 (QRF10_13460) 2855946..2857199 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
QRF10_RS13465 (QRF10_13465) 2857192..2857704 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T283851 WP_003413174.1 NZ_CP127274:2852794-2853171 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT283851 WP_003413167.1 NZ_CP127274:2852540-2852797 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References