Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2838201..2838841 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag QRF10_RS13335 Protein ID WP_003412970.1
Coordinates 2838201..2838620 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag QRF10_RS13340 Protein ID WP_003412975.1
Coordinates 2838617..2838841 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS13305 (QRF10_13305) 2833786..2834508 - 723 WP_003412957.1 DUF1906 domain-containing protein -
QRF10_RS13310 (QRF10_13310) 2835025..2835252 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
QRF10_RS13315 (QRF10_13315) 2835249..2835650 + 402 WP_003412963.1 PIN domain-containing protein -
QRF10_RS13320 (QRF10_13320) 2835685..2836605 - 921 WP_003412965.1 restriction endonuclease -
QRF10_RS13325 (QRF10_13325) 2836946..2837191 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF10_RS13330 (QRF10_13330) 2837250..2838200 + 951 WP_003911916.1 ERCC4 domain-containing protein -
QRF10_RS13335 (QRF10_13335) 2838201..2838620 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF10_RS13340 (QRF10_13340) 2838617..2838841 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
QRF10_RS13345 (QRF10_13345) 2838872..2841715 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
QRF10_RS13350 (QRF10_13350) 2841787..2842188 - 402 WP_003412981.1 hypothetical protein -
QRF10_RS13355 (QRF10_13355) 2842188..2842658 - 471 WP_003899364.1 transcription antitermination factor NusB -
QRF10_RS13360 (QRF10_13360) 2842661..2843224 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T283849 WP_003412970.1 NZ_CP127274:c2838620-2838201 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT283849 WP_003412975.1 NZ_CP127274:c2838841-2838617 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References