Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2838201..2838841 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ08 |
| Locus tag | QRF10_RS13335 | Protein ID | WP_003412970.1 |
| Coordinates | 2838201..2838620 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ09 |
| Locus tag | QRF10_RS13340 | Protein ID | WP_003412975.1 |
| Coordinates | 2838617..2838841 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS13305 (QRF10_13305) | 2833786..2834508 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
| QRF10_RS13310 (QRF10_13310) | 2835025..2835252 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QRF10_RS13315 (QRF10_13315) | 2835249..2835650 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
| QRF10_RS13320 (QRF10_13320) | 2835685..2836605 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
| QRF10_RS13325 (QRF10_13325) | 2836946..2837191 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| QRF10_RS13330 (QRF10_13330) | 2837250..2838200 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
| QRF10_RS13335 (QRF10_13335) | 2838201..2838620 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF10_RS13340 (QRF10_13340) | 2838617..2838841 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
| QRF10_RS13345 (QRF10_13345) | 2838872..2841715 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| QRF10_RS13350 (QRF10_13350) | 2841787..2842188 | - | 402 | WP_003412981.1 | hypothetical protein | - |
| QRF10_RS13355 (QRF10_13355) | 2842188..2842658 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
| QRF10_RS13360 (QRF10_13360) | 2842661..2843224 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T283849 WP_003412970.1 NZ_CP127274:c2838620-2838201 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|