Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2792017..2792669 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPX1 |
Locus tag | QRF10_RS13140 | Protein ID | WP_003412752.1 |
Coordinates | 2792244..2792669 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | QRF10_RS13135 | Protein ID | WP_003412749.1 |
Coordinates | 2792017..2792238 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS13120 (QRF10_13120) | 2790257..2790463 | - | 207 | WP_003899347.1 | hypothetical protein | - |
QRF10_RS13125 (QRF10_13125) | 2790599..2791222 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
QRF10_RS13130 (QRF10_13130) | 2791212..2791964 | + | 753 | WP_003900859.1 | hypothetical protein | - |
QRF10_RS13135 (QRF10_13135) | 2792017..2792238 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
QRF10_RS13140 (QRF10_13140) | 2792244..2792669 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF10_RS13145 (QRF10_13145) | 2792692..2793873 | - | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
QRF10_RS13150 (QRF10_13150) | 2793870..2794916 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
QRF10_RS13155 (QRF10_13155) | 2794927..2796030 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
QRF10_RS13160 (QRF10_13160) | 2796289..2797110 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
QRF10_RS13165 (QRF10_13165) | 2797107..2797664 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T283848 WP_003412752.1 NZ_CP127274:2792244-2792669 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TPX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |