Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2386127..2386656 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QRF10_RS11220 Protein ID WP_057171774.1
Coordinates 2386127..2386444 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag QRF10_RS11225 Protein ID WP_003411127.1
Coordinates 2386441..2386656 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS11190 (QRF10_11190) 2381264..2382340 + 1077 WP_003411110.1 hypothetical protein -
QRF10_RS11195 (QRF10_11195) 2382337..2382618 + 282 WP_003411112.1 DUF5703 family protein -
QRF10_RS11200 (QRF10_11200) 2382654..2383727 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
QRF10_RS11205 (QRF10_11205) 2383732..2384262 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
QRF10_RS11210 (QRF10_11210) 2384310..2385656 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
QRF10_RS11220 (QRF10_11220) 2386127..2386444 - 318 WP_057171774.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRF10_RS11225 (QRF10_11225) 2386441..2386656 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
QRF10_RS11230 (QRF10_11230) 2386911..2387969 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
QRF10_RS11235 (QRF10_11235) 2388099..2388455 - 357 WP_003411130.1 hypothetical protein -
QRF10_RS11240 (QRF10_11240) 2388550..2389332 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
QRF10_RS11245 (QRF10_11245) 2389600..2389890 - 291 WP_003900476.1 YggT family protein -
QRF10_RS11250 (QRF10_11250) 2390052..2390708 - 657 WP_003411133.1 cell division protein SepF -
QRF10_RS11255 (QRF10_11255) 2390774..2391550 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12340.93 Da        Isoelectric Point: 6.4831

>T283847 WP_057171774.1 NZ_CP127274:c2386444-2386127 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEVEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT283847 WP_003411127.1 NZ_CP127274:c2386656-2386441 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References