Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2348020..2348715 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53501 |
| Locus tag | QRF10_RS11010 | Protein ID | WP_003410811.1 |
| Coordinates | 2348020..2348454 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | QRF10_RS11015 | Protein ID | WP_003410814.1 |
| Coordinates | 2348461..2348715 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS11000 (QRF10_11000) | 2344174..2347215 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
| QRF10_RS11005 (QRF10_11005) | 2347208..2348041 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| QRF10_RS11010 (QRF10_11010) | 2348020..2348454 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF10_RS11015 (QRF10_11015) | 2348461..2348715 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| QRF10_RS11020 (QRF10_11020) | 2348731..2348988 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| QRF10_RS11025 (QRF10_11025) | 2349399..2350660 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| QRF10_RS11030 (QRF10_11030) | 2351293..2351589 | + | 297 | WP_003410820.1 | PE family protein | - |
| QRF10_RS11035 (QRF10_11035) | 2351645..2352376 | + | 732 | WP_003900467.1 | PPE family protein | - |
| QRF10_RS11040 (QRF10_11040) | 2352917..2353663 | - | 747 | WP_003906749.1 | proteasome subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T283846 WP_003410811.1 NZ_CP127274:c2348454-2348020 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMN0 |