Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2218239..2218825 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QRF10_RS10430 | Protein ID | WP_003912702.1 |
Coordinates | 2218239..2218583 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | QRF10_RS10435 | Protein ID | WP_003410014.1 |
Coordinates | 2218577..2218825 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS10395 (QRF10_10395) | 2213945..2214544 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
QRF10_RS10400 (QRF10_10400) | 2214960..2215388 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
QRF10_RS10405 (QRF10_10405) | 2215614..2216153 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
QRF10_RS10410 (QRF10_10410) | 2216673..2217233 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
QRF10_RS10415 (QRF10_10415) | 2217230..2217571 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
QRF10_RS10420 (QRF10_10420) | 2217657..2217914 | + | 258 | WP_003410006.1 | hypothetical protein | - |
QRF10_RS10425 (QRF10_10425) | 2217815..2218150 | - | 336 | WP_003410009.1 | dehydrogenase | - |
QRF10_RS10430 (QRF10_10430) | 2218239..2218583 | - | 345 | WP_003912702.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
QRF10_RS10435 (QRF10_10435) | 2218577..2218825 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QRF10_RS10440 (QRF10_10440) | 2218925..2221240 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
QRF10_RS10445 (QRF10_10445) | 2221237..2221509 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
QRF10_RS10450 (QRF10_10450) | 2221562..2221918 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
QRF10_RS10455 (QRF10_10455) | 2222075..2222842 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12260.15 Da Isoelectric Point: 9.8887
>T283842 WP_003912702.1 NZ_CP127274:c2218583-2218239 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPSNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPSNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7WJ0 | |
PDB | 7WNR | |
AlphaFold DB | A0A7U4FAW9 |