Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2187615..2188159 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag QRF10_RS10245 Protein ID WP_003409896.1
Coordinates 2187615..2187911 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag QRF10_RS10250 Protein ID WP_003409899.1
Coordinates 2187908..2188159 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS10190 (QRF10_10190) 2182648..2182998 - 351 WP_003899096.1 hypothetical protein -
QRF10_RS10195 (QRF10_10195) 2183009..2183911 - 903 WP_003899097.1 hypothetical protein -
QRF10_RS10200 (QRF10_10200) 2183932..2184123 - 192 WP_003409876.1 hypothetical protein -
QRF10_RS10205 (QRF10_10205) 2184124..2184420 - 297 WP_003409877.1 hypothetical protein -
QRF10_RS10210 (QRF10_10210) 2184660..2184875 + 216 WP_003409878.1 antitoxin -
QRF10_RS10215 (QRF10_10215) 2184872..2185183 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
QRF10_RS10220 (QRF10_10220) 2185157..2185678 - 522 WP_003904745.1 hypothetical protein -
QRF10_RS10225 (QRF10_10225) 2185653..2186030 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
QRF10_RS10230 (QRF10_10230) 2186072..2186521 + 450 WP_003913306.1 type II toxin-antitoxin system antitoxin HigA -
QRF10_RS10235 (QRF10_10235) 2186518..2187063 + 546 WP_003409891.1 SecB-like chaperone -
QRF10_RS10240 (QRF10_10240) 2186952..2187566 - 615 WP_003901296.1 hypothetical protein -
QRF10_RS10245 (QRF10_10245) 2187615..2187911 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRF10_RS10250 (QRF10_10250) 2187908..2188159 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QRF10_RS10255 (QRF10_10255) 2188146..2188640 + 495 WP_003899099.1 hypothetical protein -
QRF10_RS10260 (QRF10_10260) 2188800..2189207 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
QRF10_RS10265 (QRF10_10265) 2189211..2189483 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QRF10_RS10270 (QRF10_10270) 2189516..2190736 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
QRF10_RS10275 (QRF10_10275) 2191634..2192431 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T283839 WP_003409896.1 NZ_CP127274:c2187911-2187615 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT283839 WP_003409899.1 NZ_CP127274:c2188159-2187908 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References