Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1937797..1938410 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | QRF10_RS09060 | Protein ID | WP_003408465.1 |
Coordinates | 1937797..1938186 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | QRF10_RS09065 | Protein ID | WP_003408469.1 |
Coordinates | 1938183..1938410 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS09025 (QRF10_09025) | 1933426..1934340 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
QRF10_RS09030 (QRF10_09030) | 1934343..1935173 | + | 831 | WP_003408448.1 | cyclase family protein | - |
QRF10_RS09035 (QRF10_09035) | 1935173..1935523 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
QRF10_RS09040 (QRF10_09040) | 1935576..1936394 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
QRF10_RS09045 (QRF10_09045) | 1936408..1937187 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
QRF10_RS09055 (QRF10_09055) | 1937618..1937749 | + | 132 | Protein_1786 | IS3 family transposase | - |
QRF10_RS09060 (QRF10_09060) | 1937797..1938186 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF10_RS09065 (QRF10_09065) | 1938183..1938410 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
QRF10_RS09070 (QRF10_09070) | 1938628..1940112 | + | 1485 | WP_003408473.1 | biotin carboxylase | - |
QRF10_RS09075 (QRF10_09075) | 1940109..1941356 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
QRF10_RS09080 (QRF10_09080) | 1941399..1941818 | - | 420 | WP_003408483.1 | hypothetical protein | - |
QRF10_RS09085 (QRF10_09085) | 1941808..1942518 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T283835 WP_003408465.1 NZ_CP127274:c1938186-1937797 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7E4J | |
AlphaFold DB | A0A7U4FAN9 |