Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1764769..1765382 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | QRF10_RS08310 | Protein ID | WP_003407786.1 |
Coordinates | 1764978..1765382 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | QRF10_RS08305 | Protein ID | WP_009935474.1 |
Coordinates | 1764769..1764972 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS08275 (QRF10_08275) | 1760174..1760554 | + | 381 | WP_003407768.1 | fumarate reductase subunit C | - |
QRF10_RS08280 (QRF10_08280) | 1760551..1760928 | + | 378 | WP_003407771.1 | fumarate reductase subunit FrdD | - |
QRF10_RS08285 (QRF10_08285) | 1760996..1761604 | + | 609 | WP_003407773.1 | TetR/AcrR family transcriptional regulator | - |
QRF10_RS08290 (QRF10_08290) | 1761788..1762936 | + | 1149 | Protein_1635 | MMPL family transporter | - |
QRF10_RS08295 (QRF10_08295) | 1762946..1763392 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
QRF10_RS08300 (QRF10_08300) | 1763427..1764716 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
QRF10_RS08305 (QRF10_08305) | 1764769..1764972 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF10_RS08310 (QRF10_08310) | 1764978..1765382 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
QRF10_RS08315 (QRF10_08315) | 1765399..1767141 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
QRF10_RS08320 (QRF10_08320) | 1767134..1769431 | - | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T283834 WP_003407786.1 NZ_CP127274:1764978-1765382 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|