Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1686270..1686886 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | QRF10_RS07965 | Protein ID | WP_003407593.1 |
Coordinates | 1686569..1686886 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | QRF10_RS07960 | Protein ID | WP_003900349.1 |
Coordinates | 1686270..1686572 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS07950 (QRF10_07950) | 1682156..1684003 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
QRF10_RS07955 (QRF10_07955) | 1684004..1686256 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
QRF10_RS07960 (QRF10_07960) | 1686270..1686572 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
QRF10_RS07965 (QRF10_07965) | 1686569..1686886 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
QRF10_RS07970 (QRF10_07970) | 1686883..1687887 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
QRF10_RS07975 (QRF10_07975) | 1687940..1689229 | + | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
QRF10_RS07980 (QRF10_07980) | 1689302..1690027 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
QRF10_RS07985 (QRF10_07985) | 1690133..1690345 | - | 213 | WP_003898900.1 | dodecin family protein | - |
QRF10_RS07990 (QRF10_07990) | 1690406..1690804 | + | 399 | WP_003900351.1 | hypothetical protein | - |
QRF10_RS07995 (QRF10_07995) | 1690849..1691877 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T283833 WP_003407593.1 NZ_CP127274:1686569-1686886 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|