Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1388684..1389243 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0THS1 |
Locus tag | QRF10_RS06660 | Protein ID | WP_003898789.1 |
Coordinates | 1388684..1388977 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0THS2 |
Locus tag | QRF10_RS06665 | Protein ID | WP_003406322.1 |
Coordinates | 1388974..1389243 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS06635 (QRF10_06635) | 1384277..1384537 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
QRF10_RS06640 (QRF10_06640) | 1384534..1384965 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS06645 (QRF10_06645) | 1384988..1386676 | - | 1689 | WP_003910308.1 | PE family protein | - |
QRF10_RS06650 (QRF10_06650) | 1386856..1387716 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
QRF10_RS06655 (QRF10_06655) | 1387797..1388627 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
QRF10_RS06660 (QRF10_06660) | 1388684..1388977 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
QRF10_RS06665 (QRF10_06665) | 1388974..1389243 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRF10_RS06670 (QRF10_06670) | 1389356..1393051 | - | 3696 | WP_003898790.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
QRF10_RS06675 (QRF10_06675) | 1393193..1393981 | - | 789 | WP_003406325.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T283831 WP_003898789.1 NZ_CP127274:c1388977-1388684 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|